Protein Info for Atu4776 in Agrobacterium fabrum C58

Annotation: formate dehydrogenase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 TIGR01701: oxidoreductase alpha (molybdopterin) subunit" amino acids 16 to 761 (746 residues), 961.6 bits, see alignment E=1.3e-293 PF00384: Molybdopterin" amino acids 112 to 495 (384 residues), 91.6 bits, see alignment E=5.2e-30 PF01568: Molydop_binding" amino acids 647 to 756 (110 residues), 43.4 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 57% identical to YDEP_ECO57: Protein YdeP (ydeP) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to atu:Atu4776)

Predicted SEED Role

"Putative formate dehydrogenase oxidoreductase protein" in subsystem Formate hydrogenase

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH47 at UniProt or InterPro

Protein Sequence (764 amino acids)

>Atu4776 formate dehydrogenase alpha subunit (Agrobacterium fabrum C58)
MAEERPEGIEKYNHPAGGWDALKAVAKTLAHQQIIAQGTMTLLKANQPEGFDCPGCAWPD
PQHTSSFEFCENGAKAITWESTAKRSGPEFFAQHTVSELWQWTDHKLEDAGRLTLPLHYN
ADSDRYEPIAWHDAFHLIAQELNKLDNPDKAEFYTSGRASNEAAFLYQLFVRAYGTNNFP
DCSNMCHEATSVGLPKSIGVGKGTVTLEDFDYADAIFSFGHNPGTNHPRMMTTLHNAAKR
GVPIVVFNPLKERALERFAAPQDPIEMATLSSTPIASAYHQLRTGGDLAALKGIMKAVFE
LDAENLGAGGAGVLDRAFIEEHTAGLEALRADIDATSWDIISSVSGLTKEALESAARIYV
KASNVIICYGMGITQHAKGTGNVQQIANLLLLRGNMGRPGAGIAPIRGHSNVQGDRTVGI
TEIPNKALLDGMERAFGFRPPAEKGHNAIEAIEAIIAGKSRALICLGGNLAVAMSDTAAT
FEGMRKLDLVVHIATKLNRSHLLTARTSLILPCFGRTDLDTQASGPQAVTVEDSMSMVHA
SRGFLNPPGELVRSEPAIIAAIAKATVGNRYGIDWDWLIADYDRVRDKIEEVFPDFRDFN
SRVRMKGGFRLDVAASYRRWNTESGKANFLVATGLEEDPLISNPDALVLTTIRSHDQYNT
TIYGMDDRYRGVFGRRDIIFMNRHDLAERGLKDGDRIDIHGIGAESADRHLVQGFTAVEY
NIPKGSAAGYYPEMNAVVALGHYDRLSGTPSYKGVPITISPAAT