Protein Info for Atu4774 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00072: Response_reg" amino acids 16 to 125 (110 residues), 99 bits, see alignment E=1.9e-32 PF00196: GerE" amino acids 151 to 206 (56 residues), 77.6 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 55% identical to NODW_BRADU: Nodulation protein W (nodW) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4774)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH45 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Atu4774 two component response regulator (Agrobacterium fabrum C58)
MSEPRKTTKEPLSPVVFIVDDDVSMREALTDLFRSMKFDAEAFDSAAAFLEKANLNRHGC
LLLDVRLPGISGLDFQVQLERVGNRMPIIFMTGFGDIPMSVRAMKAGAVDFLTKPFKEQD
ILDAVAAAMERDASRRRESAQNEAVTSLAGQLTPREREVMGAVVRGLMNKQIAYELGISE
VTVKLHRGNVMRKMEARSVADLVRKAELIGEKLRPPVS