Protein Info for Atu4754 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 85 to 95 (11 residues), see Phobius details amino acids 133 to 133 (1 residues), see Phobius details amino acids 135 to 148 (14 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details TIGR03004: ectoine/hydroxyectoine ABC transporter, permease protein EhuC" amino acids 4 to 217 (214 residues), 366 bits, see alignment E=6.9e-114 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 7 to 104 (98 residues), 90.1 bits, see alignment E=1.1e-29 PF00528: BPD_transp_1" amino acids 28 to 210 (183 residues), 63.5 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 50% identical to Y4TF_SINFN: Probable amino-acid ABC transporter permease protein y4tF (NGR_a01530) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu4754)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH31 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Atu4754 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MDMTAYLPMLWQGAVVTMTITLAALVVGTVLAFFFGILRVEGGPILSTVALCYTEVFRGT
SLLVQLFWFYYALPLIGLSFDPVTTGVMVLAAHAGGYGAEIVRGALSSVSVQQLEAARAL
NFTRMQTLFRISLPQAVVEMMPAFGNLAIETLKLSSLVSLISIADLTFAAQSIRNLTLDS
TSIYSITLLCYFAMSLILMVIIRVIEHVVRRGNVFPRTRHS