Protein Info for Atu4738 in Agrobacterium fabrum C58

Annotation: chloramphenicol acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 187 to 203 (17 residues), see Phobius details PF00132: Hexapep" amino acids 109 to 143 (35 residues), 38 bits, see alignment 9e-14 PF14602: Hexapep_2" amino acids 110 to 138 (29 residues), 27.5 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 100% identical to CAT4_AGRFC: Chloramphenicol acetyltransferase (cat) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00638, chloramphenicol O-acetyltransferase [EC: 2.3.1.28] (inferred from 100% identity to atu:Atu4738)

Predicted SEED Role

"Chloramphenicol acetyltransferase (EC 2.3.1.28)" (EC 2.3.1.28)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.28

Use Curated BLAST to search for 2.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23364 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Atu4738 chloramphenicol acetyltransferase (Agrobacterium fabrum C58)
MENYFESPFRGITLDKQVKSPNLVVGKYSYYSGYYHGHSFEDCARYLLPDEGADRLVIGS
FCSIGSGAAFIMAGNQGHRNEWISTFPFFFMPEVPEFENAANGYLPAGDTVIGNDVWIGS
EAIIMPGITVGDGAVIGTRALVTKDVEPYAIVGGNPAKTIRKRFDDDSIALLLEMKWWGW
PAERLKAAMPLMTSGNVAALYRFWRSDSL