Protein Info for Atu4732 in Agrobacterium fabrum C58

Annotation: fimbrial chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00345: PapD_N" amino acids 25 to 143 (119 residues), 82.8 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: K07346, fimbrial chaperone protein (inferred from 100% identity to atu:Atu4732)

Predicted SEED Role

"Sigma-fimbriae chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH21 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Atu4732 fimbrial chaperone (Agrobacterium fabrum C58)
MRLFTLAAAFFAGLSVSPSQAASLRVAPVLLDLKAPTAASSLRIWNDAKTPINVQVRIFR
WTQQNGQDVYTAVNDVVASPPMTQLKGGAENLIRIVRLSKTPVRAEESYRIIVDELPPAG
KPQSGTVNLVVRHSIPVFFSPASTGDAEPVWKVTPQGKGYKVSVSNAGERRIRIANLILS
GGNGQPIGRQQGLVGYVLGKSAATFLVPATGGKAGGTLKISADSEGGPVNATARVSGG