Protein Info for Atu4728 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 32 to 306 (275 residues), 74.5 bits, see alignment E=1.2e-24 PF00005: ABC_tran" amino acids 371 to 519 (149 residues), 115.3 bits, see alignment E=3.4e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to atu:Atu4728)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH18 at UniProt or InterPro

Protein Sequence (600 amino acids)

>Atu4728 ABC transporter permease (Agrobacterium fabrum C58)
MSRKKLDFRADAYRHVLGFVFNHWSHRKALVGFIIVLVVASTLAEVMVPVFSGRIVDAIA
GDNGGANAGDGALRAFVIVVALGFTSVVLRWFIFNGIIRLTLKTMADVTNNGFHKVQRFS
TDWHANSFAGSTVRKITRGMWALDSLNDLLLVALLPSIVMLVGATVVLGSYWPVMGLIVG
LGSLIYIGVTVGLSMGYVSPAARLANAWDTRLGGALADAISCNAVVKAFGAETREETRLG
HVLVKWDNRTRRTWKRGTLNGTIQSFMMVSMQAGILGTGLIMWQKGLATAGDITFVLAMF
FVLQGYLRDVGQDIRNLQRAVNDMEELVLLDKMPLGVEDRPDAKRINIGKGEIVFDHVTF
QYGAHATPLYEDFSVTIKPGERVGLVGHSGSGKTTFVKLIQRLYDIKAGAIRIDGQNIAD
VTQASLRGQIAIVQQEPILFHRTLAENIAYGRPDASRREIEQAAKQASAHDFIMSLPKGY
ETMVGERGVKLSGGERQRVAIARAFLADAPVLILDEATSSLDSESEVQIQQAMERLMDGR
TTLVIAHRLSTVRALDRLLVFDKGRIVEEGDHQALIRLHDGIYRRLFERQALELTKGLVA