Protein Info for Atu4721 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 71 to 96 (26 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF12911: OppC_N" amino acids 2 to 44 (43 residues), 29.5 bits, see alignment 5.4e-11 PF00528: BPD_transp_1" amino acids 85 to 266 (182 residues), 110 bits, see alignment E=1.2e-35

Best Hits

Swiss-Prot: 52% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4721)

MetaCyc: 37% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVP3 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Atu4721 dipeptide ABC transporter permease (Agrobacterium fabrum C58)
MKRNKSALAGLIIVLFFAVLAIAAPILPIADPVATSWSAIRKAPSAAHWLGTDDLGRDIL
SRMIYGARASLMAGVVSVMIAVVIGVPFGLIAGYFGGWVDMVISRITEALLAMPFLIMAI
ALAAFLGPSLTNAMIAIGLSAMPIFVRLTRGQVLAVKMEDYVEGARSIGLNHIDIMTRYI
LPNVFAPIIVQATLTVATAIIAEASLSFLGLGQQAPAPSWGSMLNTAKNFLSQAPWMTLW
PGIAIFLVVIGFNLLGDGLRDALDPREA