Protein Info for Atu4716 in Agrobacterium fabrum C58

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF13188: PAS_8" amino acids 15 to 58 (44 residues), 18.1 bits, see alignment 5e-07 amino acids 142 to 193 (52 residues), 27.8 bits, see alignment 4.4e-10 amino acids 272 to 326 (55 residues), 15.9 bits, see alignment 2.5e-06 TIGR00229: PAS domain S-box protein" amino acids 139 to 261 (123 residues), 34 bits, see alignment E=1.5e-12 amino acids 262 to 386 (125 residues), 35.8 bits, see alignment E=3.9e-13 PF13426: PAS_9" amino acids 158 to 210 (53 residues), 27.4 bits, see alignment 8.7e-10 amino acids 285 to 378 (94 residues), 21.6 bits, see alignment E=5.4e-08 PF00196: GerE" amino acids 427 to 481 (55 residues), 51.7 bits, see alignment 1.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4716)

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH14 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Atu4716 LuxR family transcriptional regulator (Agrobacterium fabrum C58)
MDDSEDIPKINRLVLQNLIAGLSDGLILLENDGTIAWANRAALEMHRKEAISELGADTES
YRRNFTLRYRNNHLLDEGQYPLERLLAGETFEDVTVEISPSDDETECWVHTVRGLILEDA
GAKPDVLVLIIRDETPRFEAEARFESAFNANPAPGLICRLEDERFIRVNQGFLEMTGFSR
EEIIGVSVEELGLFSECETGEDALKRLHEGRIIRQREALIPIPGGDRLVIVAGETIAVAE
EPCMLFTFADLDGRRKAQNALRQSEERFFKSFRLSPVPAAISRLDDFVLTEVNDAFLTLC
GRKEAEVVGKTASELRLWDDVPARRDIEKRLKDNIPIRNEAMRMNLADDGTAECIVSAER
AEINDQLCVIWAIQDVTERRRSENELIEAIESVMTDTSWFSRTVVERLAGLRQNSRGASP
SASLKDLTDREEQILSLICDGSSDKEMSDRLNLSKHTIRNHIASLYGKIGVNRRTAAVIW
ARERGFTGRREK