Protein Info for Atu4707 in Agrobacterium fabrum C58

Annotation: NADH ubiquinone oxidoreductase chain F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF01512: Complex1_51K" amino acids 145 to 316 (172 residues), 152.1 bits, see alignment E=1.1e-48 PF10589: NADH_4Fe-4S" amino acids 429 to 508 (80 residues), 92.5 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to atu:Atu4707)

Predicted SEED Role

"NAD-dependent formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH10 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Atu4707 NADH ubiquinone oxidoreductase chain F (Agrobacterium fabrum C58)
MSVTVFIPGDSAALAVGANRVAEAIAREAASRNLDVQIVRNGSRGMLWLEVLVEVRTEHG
RIAYGPVKAADVTSLFDADFLDGGDHRLCLGPTKDIPFLKNQTRLTFARCGVTDPLSLED
YRNYQGMKGLEKAVTMEPLAIVAQVTESGLRGRGGAGFPTGIKWKTVADARADQKYIVCN
ADEGDSGTFADRMIMEGDPFVLIEGMAIAGLAVGATKGFIYTRSEYPYAIKVMEKAIEIA
RREGILGSSVLGSGRAFDMEVRMGAGAYVCGEETSLLNSLEGKRGTVRAKPPLPALQGLF
GKPTVVNNVISLASIPVIMDRGAAFYRDFGVGRSHGTIPIQLAGNIRYGGLYETAFGLTL
GQLVNDIGGGTITGRPVKAVQVGGPLGAYFPVSLFDTIFDYEAFTAAGGLIGHAGIVVFD
DTADMLHQARFALEFCAVESCGKCTPCRIGSTRGVETVDKIALGIEREKNTALLEDLCET
MKFGSLCALGGFTPYPVMSALRHFPQDFAPIPRVEAAE