Protein Info for Atu4697 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 105 to 131 (27 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 231 to 257 (27 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 64 (40 residues), 39.8 bits, see alignment 3.5e-14 PF00528: BPD_transp_1" amino acids 121 to 315 (195 residues), 106.1 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4697)

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH07 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu4697 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MTDLSQTEKPARRSLFSHMRDSDLYWSFSRSKSAKISALVLAILILAAIFAPWIAPQNPY
DGASLDMWKAELPPIWQEGGEWPFLLGTDTQGRDMLSAILYGTRISIVIGVASVVLSLVI
GMTAGLVAGYFGGFADGLLMRIGDITLSIPTILVAILVSTVVRQMLPDSLREVGASAVLI
LAIALSAWVQYARTVRAQAIVETGKDYVQAAKLIGVPARRIMAAHILPNTLTPIMVAATL
NFGMAILTEATLSFLGIGMPPSQPSLGTLIRIGNQFLFSGSWWIVLFPVFQLCLLVVTVN
LLGDWLRDALNPKLR