Protein Info for Atu4688 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 91 to 106 (16 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 191 to 217 (27 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 111 (96 residues), 97.5 bits, see alignment E=2.6e-32 PF00528: BPD_transp_1" amino acids 37 to 212 (176 residues), 57.2 bits, see alignment E=9.6e-20

Best Hits

Swiss-Prot: 34% identical to GLNP_RICBR: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu4688)

Predicted SEED Role

"ABC transporter, membrane spanning protein [amino acid]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH02 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Atu4688 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MSYTFQFGALAQYQNELLSGIWLTIKLSVLSIVLGCAFGILLASLRSINGGIVRIIVDGY
VEVIRNTPFLVQLFIVYFGLPGLGFRVGADTAALIGMTINLAAYSTEIIRAGIEAVHKSQ
IEAGEALGFTKYQIYRHVIIVPAIAKVYPSLCSQFVLMMLASSICSAISTHELAAAAAFV
ESQTYRSFEVYIVVTLIYLALALSLRLILALVGMWLFGRRVARKTMTALPEVQS