Protein Info for Atu4681 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter ATPase/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 164 (148 residues), 127.9 bits, E=6.8e-41

Best Hits

Swiss-Prot: 54% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to atu:Atu4681)

MetaCyc: 54% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

See A9CGZ8 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Atu4681 amino acid ABC transporter ATPase/permease (Agrobacterium fabrum C58)
MIEIENVRKSFGPLEVLKGINLTVNKGEVVTIIGGSGSGKSTLLTCINGLEPIDSGKIAI
DGTEVHAKSTDLNKLRRKVGIVFQQWNAFPHLTVLENVMLAPRKVLGISKEKAEEIAVKQ
LTHVGLAEKLKVYPNRMSGGQQQRMAIARALAMSPEYMLFDEVTSALDPMLVGEVLDTLK
MLADEGMTMICVTHEMAFARDVSNRVAFFHQGVMAEIGTPDQLFGAPQHPETQKFLASVR