Protein Info for Atu4664 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF00005: ABC_tran" amino acids 45 to 205 (161 residues), 112.3 bits, see alignment E=9.9e-36 amino acids 324 to 476 (153 residues), 103.9 bits, see alignment E=4e-33 PF08352: oligo_HPY" amino acids 257 to 284 (28 residues), 19.4 bits, see alignment (E = 3.9e-07) amino acids 527 to 554 (28 residues), 17.8 bits, see alignment (E = 1.3e-06)

Best Hits

Swiss-Prot: 50% identical to YEJF_ECOLI: Uncharacterized ABC transporter ATP-binding protein YejF (yejF) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu4664)

MetaCyc: 50% identical to putative oligopeptide ABC transporter ATP binding subunit YejF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVJ2 at UniProt or InterPro

Protein Sequence (555 amino acids)

>Atu4664 oligopeptide ABC transporter ATPase (Agrobacterium fabrum C58)
MVAAQNNAYAPAIRFDADDRQDNAIIDARNIAVTFKVEHGTVEAVKDISFQLYRGETIAI
VGESGSGKSVTARTIMGLLTKRASVSKSATVRFNGDDILRFSSRQRRALRGNRISMIFQE
PMSSLNPIYTIGSQIVEAIRVHSRLSRKEAEARALDLLRQVQIPEPEARLKQYPHQLSGG
QRQRVMIAMALSNDPDVLIADEPTTALDVTVQAQILNLIRDLQKKRGMAVVLITHDLTIV
KQFSDYVYVMQHGEMREHNTTERLFAAPQHPYTKRLLASEPRGTAKPLPENSGVLLTASG
VRVSFMMRYGGLFKPELKELIAVDSLGLTLKRHETLGLVGESGSGKTTFGQSLLRLNEPV
GGEVIFDGERVDGRSRSEMRPLRSRMQIVFQDPFASLNPRMTIGQIIEEGLIINGLGRTK
AERLERVRDALEAAGMPGNILSRFPHEFSGGQRQRIAIARAVALEPEFILLDEPTSALDL
SVQAQIIDLLRKLQDERGLSYLFISHDLKVVRALCHRVIVMQGGRIVEEGPVEDVLTNPK
TEYTQRLVRAAFEIA