Protein Info for Atu4663 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 222 to 253 (32 residues), see Phobius details amino acids 297 to 324 (28 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details PF12911: OppC_N" amino acids 26 to 76 (51 residues), 48.9 bits, see alignment 4.9e-17 PF00528: BPD_transp_1" amino acids 190 to 377 (188 residues), 74.5 bits, see alignment E=9.5e-25

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4663)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVJ1 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Atu4663 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MMAFDDLKNETAVMPKPERGTQGNESYLALVWRRLRRSVTGMLGLVLVALLILIAIFADF
FAPMNPLETNASFSPPQVVRFTDKDGNFSPFPRVYATADTAELDPVTFQPIVGPDYDNPV
YLGFFVKGSEYRLLGLIPMSRHFFGSTDGKPVHFLGTDKFGRDVLSRAIYGSRISLAIAL
SVVAIVTVIGTSVGLISGYFGGPLDAWLQRFVEVVLAFPQLPLYLALTSLIPVTAPTTVF
LLFVVGVMSALGWAQMSREVRGKTLALARIDYVRAAIAVGATDRRIIFQHILPNVMSHVI
VAVTLHIPSVVLLESFLGFLGFAVKPPLISWGLMLQDTATYSVIGSYPWILAPVGFVLVT
VFAFNALGDGLRDAVDPY