Protein Info for Atu4654 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 334 (292 residues), 133.7 bits, see alignment E=1.5e-42 PF13416: SBP_bac_8" amino acids 47 to 361 (315 residues), 128.8 bits, see alignment E=3.7e-41

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to atu:Atu4654)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGY7 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Atu4654 sugar ABC transporter substrate-binding protein (Agrobacterium fabrum C58)
MEGYMRRATLFAGLVAGFSTFAFNAAQAVEIEYWQYVFDTRVKAMDELIAEFQKANPDIT
VKQVTFPYADYQTRVIAANLSGKGPDVMQLFYGWLDKFAAGGILQPLPKDAFPHDKIESE
FFPIVSAMKRGDDYYGLPTAVRSLALFYNKKLFTEAGLDAANPPKTLDEFVAAAEKIAKH
DAAGNLTVAGSTLDMGGQDHQWWREVLIRQYGGEPYADNDQKVTYNSEPGIQALKFYTSL
QLEKKIGQVGFMDEGQAAFRAGKAGMTIDGTFRLGSFRTIKDFEWGVTELPTNDKNIRSN
YASYFANGISAKTTGEELEASKKFLAYISSPEAMAIWLKTVGELPARRSAALTEENLKDP
IYAPFLKGLEYAHTTLFMDEAAQRQNAIDMTNRVLLEGQSVEDSVKQAAEAEQEIIDAAK
P