Protein Info for Atu4651 in Agrobacterium fabrum C58

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR00838: argininosuccinate lyase" amino acids 1 to 422 (422 residues), 295 bits, see alignment E=5.8e-92 PF00206: Lyase_1" amino acids 11 to 259 (249 residues), 139.4 bits, see alignment E=1.9e-44 PF14698: ASL_C2" amino acids 324 to 400 (77 residues), 32.6 bits, see alignment E=8.6e-12

Best Hits

Swiss-Prot: 100% identical to ARLY2_AGRFC: Argininosuccinate lyase 2 (argH2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to atu:Atu4651)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.1

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U705 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Atu4651 argininosuccinate lyase (Agrobacterium fabrum C58)
MLRETGILDAETAAKIAGALEDIDRTIEPSELVYTGEVEDFFFLIEKELKARIGVDVAGR
LHTARSRNDIDHTLFKIGLKDKIDTLTAKARVLLKALIDAAERNQSTLIVAYTHGQPAQP
TTFGHYLSAAIEVLIRDIERFTEARHIVDLSPMGAAAITTSGFPIDRARVAELLGFAAPL
RNSYSCIAAVDYTTATYGAIELMFLHLGRLIQDFQFWTSFEVGQIYVPNSLVQISSIMPQ
KRNPVPIEHLRHLASQTFGRARTMLDVMHNTPFTDMNDSEGETQSMGYEAFASAGRVLDL
LASLVGQISIDPERVDQNIRRSCITITELADSLVRIEDLSFRQAHEIAATVAKSVVALKG
DLPNDGYQPFLGAFSGLTGRETGIDEEKFRQIVSPEHFVAVRSRFGGPAPEPMREAFAAY
RGKLGAFEAEAQRSTNHEAAKAAELAEKFTALTGAR