Protein Info for Atu4637 in Agrobacterium fabrum C58

Annotation: nolF secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 61 to 381 (321 residues), 315.4 bits, see alignment E=1.8e-98 PF25917: BSH_RND" amino acids 85 to 218 (134 residues), 34.7 bits, see alignment E=3.3e-12 PF25973: BSH_CzcB" amino acids 88 to 226 (139 residues), 34.8 bits, see alignment E=3.1e-12 PF25954: Beta-barrel_RND_2" amino acids 236 to 300 (65 residues), 41.8 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 35% identical to NOLF_RHIME: Nodulation protein NolF (nolF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4637)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVG6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Atu4637 nolF secretion protein (Agrobacterium fabrum C58)
MALQWVKRTIKAGAALAGCVLVVTALDPARGSVDAKERVKGIVAAAAMSPAGIPFELAAQ
EIATIGTRPMAERLSISGELQPVNRVLIRAREAGKILEMNVREGQAVRAGDMLVRFETDE
LQSTLLLRQSDRDAAEAELMLAMQALARTEQLAAKNIASTEQLDKAKSDVVVKTTRVQSL
SSQVDIARLALRNAEIRAPFDGTVTRRVAETGARIGADGELLTLVDTSELEAKVLVATRD
IPRVARGQTAELEIDGLAGQIVKGTVERISPVAEDGTRVVAVYLRLANRDGQLWGGMFAG
GSILLREKNDALVVPAIALRKDETGYHVLKIQDGHLRRQTVAVGPRWNGGSLIEIGAGLA
DGETILTVPLPELRPDMAVTIDKAG