Protein Info for Atu4622 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 73 (49 residues), 48.1 bits, see alignment 8.7e-17 PF00528: BPD_transp_1" amino acids 114 to 295 (182 residues), 105.6 bits, see alignment E=2.7e-34

Best Hits

Swiss-Prot: 46% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4622)

MetaCyc: 46% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGW9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Atu4622 dipeptide ABC transporter permease (Agrobacterium fabrum C58)
MTDITHTNPVPRRSALSRLSTTTGRTLRKLADEPLGMFGFAILAILVLVAVFAPLIAPFD
PASQVLENALQPPSWAHLAGTDEFGRDIFSRLVYGTRITIQTVLSVSIIVGPIGLAIGVM
AGFFGGRTDAILMRATDIVLSFPSLVLALAFAAAMGAGLGTAIIAISLTAWPPIARLARA
EALVVRNTDYVAAARLYGASPLRILFLYIAPMCIPSVIVRLTLNMAGIILTAASLGFLGL
GAQPPLPEWGAMISSGRKFMLDYWWVAVMPGIAILLTSLAFNIAGDTLRDLLDPRHARS