Protein Info for Atu4618 in Agrobacterium fabrum C58

Annotation: dTDP-rhamnose-3,5-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00908: dTDP_sugar_isom
  • amino acids 7 to 176 (170 residues), 228.9 bits, E=1.5e-72
• TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase
  • amino acids 9 to 178 (170 residues), 212.5 bits, E=1.9e-67

Best Hits

Swiss-Prot: 72% identical to RMLC_SINFN: dTDP-4-dehydrorhamnose 3,5-epimerase (NGR_a03520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to atu:Atu4618)

MetaCyc: 47% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

See Q7CVE8 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Atu4618 dTDP-rhamnose-3,5-epimerase (Agrobacterium fabrum C58)
MQLEVFPISGLKKIIPARFGDNRGYFSEVFKREWFRENVANVEFVQDNESLSAQAGTVRG
LHFQTEPFAQGKLVRCIRGRLLDVAVDIRTGSPTFGQWAAVELSPENGEQLWVPAGFAHG
FMTLVADTVISYKVTAPYSAAHDRGVKWDDPAIGINWPNVADCVLSDKDAKQPLLSELPE
YFTYRNTEN