Protein Info for Atu4616 in Agrobacterium fabrum C58

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 289 (289 residues), 348.6 bits, E=7.4e-108
• TIGR01214: dTDP-4-dehydrorhamnose reductase
  • amino acids 2 to 287 (286 residues), 323.8 bits, E=4.2e-101
• PF01370: Epimerase
  • amino acids 5 to 163 (159 residues), 72.3 bits, E=1.3e-23
• PF16363: GDP_Man_Dehyd
  • amino acids 34 to 145 (112 residues), 42.1 bits, E=2.4e-14
• PF01073: 3Beta_HSD
  • amino acids 34 to 209 (176 residues), 36.7 bits, E=7.6e-13
• PF02719: Polysacc_synt_2
  • amino acids 38 to 156 (119 residues), 36.8 bits, E=7.7e-13

Best Hits

Swiss-Prot: 61% identical to RMLD_SINFN: dTDP-4-dehydrorhamnose reductase (NGR_a03570) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to atu:Atu4616)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

See A9CGW6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Atu4616 dTDP-4-dehydrorhamnose reductase (Agrobacterium fabrum C58)
MRLAVTGRNGQVVSALQALAGADLEIVTLGRPELDLVRPENVLQALREAKPDVVVSAAAY
TAVDKAESEPDIAFAVNRDGAKAVAQAAKELGVPVIHLSTDYVFDGSKATAYVESDPTGP
TSIYGRSKLKGERAVSEATDNYVVLRTAWVYSEYGNNFVKTMLKLSESRDEINVVADQFG
CPTSATDIAAAVVAIARKLVEDSSASLRGIFHLSGTGETTWANFAKQIFAFSAENGGKSM
IVNDITTKQYPTPAPRPANSRLNCRKLEEIYGLKLPSWQTSTREVVTALAQTKKEKS