Protein Info for Atu4616 in Agrobacterium fabrum C58

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF04321: RmlD_sub_bind" amino acids 1 to 289 (289 residues), 347.5 bits, see alignment E=1.5e-107 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 287 (286 residues), 323.8 bits, see alignment E=4.2e-101 PF01370: Epimerase" amino acids 5 to 163 (159 residues), 72.3 bits, see alignment E=1.3e-23 PF01073: 3Beta_HSD" amino acids 34 to 209 (176 residues), 36.7 bits, see alignment E=7.6e-13 PF16363: GDP_Man_Dehyd" amino acids 34 to 145 (112 residues), 42.2 bits, see alignment E=2.3e-14 PF02719: Polysacc_synt_2" amino acids 38 to 156 (119 residues), 36.5 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 61% identical to RMLD_SINFN: dTDP-4-dehydrorhamnose reductase (NGR_a03570) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to atu:Atu4616)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGW6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Atu4616 dTDP-4-dehydrorhamnose reductase (Agrobacterium fabrum C58)
MRLAVTGRNGQVVSALQALAGADLEIVTLGRPELDLVRPENVLQALREAKPDVVVSAAAY
TAVDKAESEPDIAFAVNRDGAKAVAQAAKELGVPVIHLSTDYVFDGSKATAYVESDPTGP
TSIYGRSKLKGERAVSEATDNYVVLRTAWVYSEYGNNFVKTMLKLSESRDEINVVADQFG
CPTSATDIAAAVVAIARKLVEDSSASLRGIFHLSGTGETTWANFAKQIFAFSAENGGKSM
IVNDITTKQYPTPAPRPANSRLNCRKLEEIYGLKLPSWQTSTREVVTALAQTKKEKS