Protein Info for Atu4615 in Agrobacterium fabrum C58

Annotation: glucose-1-phosphate thymidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00483: NTP_transferase
  • amino acids 2 to 237 (236 residues), 251.8 bits, E=3.8e-79
• TIGR01207: glucose-1-phosphate thymidylyltransferase
  • amino acids 2 to 286 (285 residues), 491.1 bits, E=4.5e-152

Best Hits

Swiss-Prot: 81% identical to RMLA_SINFN: Probable glucose-1-phosphate thymidylyltransferase (rmlA) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 100% identity to atu:Atu4615)

MetaCyc: 71% identical to glucose-1-phosphate thymidylyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (3/4 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

See Q7CVE5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Atu4615 glucose-1-phosphate thymidylyltransferase (Agrobacterium fabrum C58)
MKGIILAGGSGTRLHPMTLAVSKQILPVYDKPMIYYPLTTLMLAGIREILIISTPHDMPL
FQNLLGDGSKWGLSIEYAVQPSPDGLAQAYMIGADFVAGSPSCLILGDNIYYGHGLPDLL
ESGTSVNDGATVFAYHVNDPERYGVVHFDSEMRALSIEEKPLKPKSNWAVTGLYFYDADV
VDIAANLKPSPRGEYEITDVNRVYLDRGKLKVSIMGRGYAWLDTGTPDSLLEAGEFVRTL
EKRQGFKIACPEEIAMTKGFITHADFALLAENAGKGDYGVYLRKLAAP