Protein Info for Atu4610 in Agrobacterium fabrum C58

Annotation: sugar nucleotide epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 5 to 117 (113 residues), 29.6 bits, see alignment E=1.2e-10 PF01370: Epimerase" amino acids 5 to 136 (132 residues), 76.2 bits, see alignment E=8.3e-25 amino acids 181 to 285 (105 residues), 69.7 bits, see alignment E=7.9e-23 PF02719: Polysacc_synt_2" amino acids 5 to 127 (123 residues), 27 bits, see alignment E=7.5e-10 amino acids 183 to 306 (124 residues), 20.8 bits, see alignment E=5.9e-08 PF16363: GDP_Man_Dehyd" amino acids 6 to 133 (128 residues), 78.8 bits, see alignment E=1.6e-25 amino acids 183 to 346 (164 residues), 48.5 bits, see alignment E=2.7e-16 PF01073: 3Beta_HSD" amino acids 6 to 135 (130 residues), 32.3 bits, see alignment E=1.7e-11 PF07993: NAD_binding_4" amino acids 78 to 266 (189 residues), 31.8 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4610)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGW4 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Atu4610 sugar nucleotide epimerase/dehydratase (Agrobacterium fabrum C58)
MRDCILVTGGAGFIGSALSKLICASDLPVVTVDSFLEQVHPSGERSEFMDDRVILLKRDV
RDANTWADLLAEYRPVKIVHLAAETGTAQSLTEATRHASVNVVGTTEMLDAFARANVRPN
RIVLASSRAIYGEGMWRDTSTGVDFYPKPRTHEMLAKGQWVPSGPSGAAAIPLPHNASIV
VPRPTSVYGATKLAQEHVLASWCGAFGVPLSILRLQNVYGEGQSPYNSYTGIINVFHRLA
REGQAIPVYEDGLIGRDFVHIDDVVEVIARVLADNSGVDHKFDVGTGTETTILEAAEVIA
ELHGAAKPVICGKFRDGDVRAAIADVGAMRAATGVSSKVSFVEGSKRVGDWLIRRGHI