Protein Info for Atu4569 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 127.7 bits, see alignment E=7.6e-41 PF08402: TOBE_2" amino acids 270 to 337 (68 residues), 46.6 bits, see alignment E=4.7e-16

Best Hits

Swiss-Prot: 46% identical to UGPC_PARDP: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu4569)

MetaCyc: 46% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGU2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Atu4569 ABC transporter permease (Agrobacterium fabrum C58)
MSELEISNISKDYGASRALHPVSITVERGEFVTILGPSGCGKSTLLRILTGISQPSGGEI
RLGGKRIDQAQPEARDIAMVFQSYALFPHMSVAKNLGFGLKMKKVAKDERARRIAHALEI
CNLTGLVDRMPRQLSGGQQQRVALARAIVMQPSLLLFDEPLSNLDAKLRDTLRHELTELH
RRIGATSLYVTHDQAEAMAMSDRIVVMNAGRVVEIGTPLELYRAPKHAFTAGFLGQTNLL
PVSAEGQQAQLPWGQSVTLDQAAAGNVQISARPENIHICADQAGDGTVSAVSFMGANALY
TVEIGGRQIRVSQSGAETLIDAGQRVALQFPGSVHLLDDSVAGEAA