Protein Info for Atu4544 in Agrobacterium fabrum C58

Annotation: 4-hydroxybenzoate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02360: 4-hydroxybenzoate 3-monooxygenase
  • amino acids 1 to 390 (390 residues), 688.7 bits, E=1e-211
• PF01494: FAD_binding_3
  • amino acids 2 to 343 (342 residues), 339.8 bits, E=1.1e-105

Best Hits

Swiss-Prot: 63% identical to PHHY_PSEAE: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 100% identity to atu:Atu4544)

MetaCyc: 63% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

• 4-coumarate degradation (aerobic) (3/5 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• bisphenol A degradation (2/5 steps found)
• 4-chlorobenzoate degradation (1/4 steps found)
• 4-methylphenol degradation to protocatechuate (1/4 steps found)
• 4-hydroxymandelate degradation (1/6 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

See Q7CV80 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Atu4544 4-hydroxybenzoate 3-monooxygenase (Agrobacterium fabrum C58)
MRTQVVIIGSGPSGLLLGQLLAGAGVETVILDRVSKDYILGRVRAGVLEEGTVQLMEKVG
ADKRLHREGLPHDGFSLTFDGRDHRIDLFDLTAGKRVMVYGQTEVTHDLMDVREAANLVT
IYDAGNVEPHDFDGAGPYVTYQKDGVNHRIDCDFIAGCDGFHGVSRKSVPDGAIKEFEKV
YPFGWLGILADVPPVNHELIYANHPRGFALCSMRSHTRSRYYIQCSLDDRPEDWSDERFF
DEIRRRLPENHADAMVTGPSFEKSIAPLRSFVSEPMRFGRLFLAGDAAHIVPPTGAKGLN
LAASDVHYLSEALIEFYRDRSEAGIDAYSQKALSRVWKAVRFSWWMTTMMHRFPDTGDFG
QRIQEAELDYLVQSRAASTALAENYVGLPY