Protein Info for Atu4538 in Agrobacterium fabrum C58

Annotation: 3-carboxy-cis,cis-muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01857, 3-carboxy-cis,cis-muconate cycloisomerase [EC: 5.5.1.2] (inferred from 100% identity to atu:Atu4538)

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

aromatic compounds degradation via β-ketoadipate (8/9 steps found)
protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
superpathway of aerobic toluene degradation (12/30 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)

KEGG Metabolic Maps

Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV75 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Atu4538 3-carboxy-cis,cis-muconate cycloisomerase (Agrobacterium fabrum C58)
MSLSPFEHPFLSGLFGDSEIVELFSARADIDAMIRFETALAQAQVGTGIISEDVAKAIVS
GLSEFAADMTALRHGVAKDGVVVPELVRQMRAAVAGKAAEKVHFGATSQDVIDTSLMLRL
KMATEIIAARLGRLIDALGDIAARDGHNALTGYTRMQAAIGITVADRAASWIAPLERHLL
RLETFAQSGFALQFGGAAGTLEKLGDNAGAVRADLAMRLGLADKQQWQSQRDGIAEFGNI
LSLVTGTLGKFGQDIALMAEIGTEIRLSGGGGSSAMPHKQNPVNAETLAALARFNAVQIS
ALHQSLVHEQERSGAGWMLEWLSLPQMVTATGASLLIAERLAAQIDRLGTNGN