Protein Info for Atu4524 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 92 to 119 (28 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 2 to 60 (59 residues), 25.1 bits, see alignment E=1.7e-09 PF00528: BPD_transp_1" amino acids 72 to 262 (191 residues), 146.7 bits, see alignment E=6.6e-47

Best Hits

Swiss-Prot: 43% identical to GSIC_SALCH: Glutathione transport system permease protein GsiC (gsiC) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4524)

MetaCyc: 43% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGS6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Atu4524 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MTEDDLARIRAALGTDRPFFVQYFSFLKGLVTLDFGRSFTGSTPVSRLIADALPATLLLA
FISMAVSIALSIPLGIKAATSRGKTADQVIRIFSLIGLSFPNFWLATMLVLLFSITLGWL
PPSGMGGFASYIMPSVTMGVILTATNVRLVRTAMLDTLRSQYVMVARAKGLSESKVLYKH
ALRNCAIPLITYFGLQFGGLLGGIVVIERVFNWPGLGTLAFDAVGARDYPVLQAVITVLS
LMIVGINLLVDIAYGLVDPRIRTE