Protein Info for Atu4517 in Agrobacterium fabrum C58

Annotation: branched chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 312 (267 residues), 117.4 bits, see alignment E=3.2e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu4517)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGS3 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Atu4517 branched chain amino acid ABC transporter permease (Agrobacterium fabrum C58)
MAVLMNDVTETAEIPKARSPLRTLAGPLLIITAAIIGYFLFPDNLALLTRIIAIALLVLS
IDLVTGYCGVATLGHAALFGAGAYAAGIAAAHFEITDPLLMTVIGAAGGGVAGLLSGTVL
LRAHGLPQLVLSIAVIHLFHEAANKASGWTGGSDGLSGVSPDALFGTFEFDLFGRTAYVY
GVCLLLLVFIALRVVVNSPFGMLCRGVKQDSIRIQAMGGSVNGTVLKMFVISGIVAGIGG
ALNAISTQVVGLDSLSFTLSAEGLVMLVLGGAGSLYGALIGTVTFMWFEDVVSAANPFHW
LTIVGLLLIAVVLFAPRGLYGAGEQIIGRLRGDRK