Protein Info for Atu4490 in Agrobacterium fabrum C58

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF05228: CHASE4" amino acids 65 to 224 (160 residues), 70 bits, see alignment E=3.6e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 302 to 462 (161 residues), 113.5 bits, see alignment E=4.1e-37 PF00990: GGDEF" amino acids 303 to 459 (157 residues), 129 bits, see alignment E=2.3e-41 PF00563: EAL" amino acids 480 to 710 (231 residues), 234.9 bits, see alignment E=1.3e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4490)

Predicted SEED Role

"FIG00984058: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CV32 at UniProt or InterPro

Protein Sequence (734 amino acids)

>Atu4490 diguanylate cyclase (Agrobacterium fabrum C58)
MRIAPRNIGDYLPVGRRTAVGVVLSTFALVLLIVTALVLSALSQVREKANLLDNARSRET
TAGALVTFRDQLGATLNDYAAWDDAAEYVYAPDRFDWVASNYGEMTVNSDLFDTAVVLDE
DGKTRMAYQDGKPVKWTYDTYFAAGLKEMIERVQAMRPSITSQVTGFVKTEDGVAAAGVA
LVRLKSGALATDSTERRYLIFARHLKQATVDKLARNYVVEGLELQYGDGPAANHVDIVNP
LGQVLARLVWRSHLPGDVSFHEARPVVFTALGIAGTFFLVLLIIGSATLDRLKADEAAAR
EEALRDRLSGLDNRAGLFAHLTRMVGKARHDKTDIKLLYLDLDGFKEINDSYGHAAGDRL
IKGVAAALRVLVPEDAVLARLGGDEFAIAIQGNDVWSEGRKLCLALLELFTEPFSIGERV
ASIGCSIGTSVSRAGDINGEELLRRADMAMYQAKENGRGRYVSYELKMDALREEKLQLEA
DLRSAILNDEIQVVYQPVVSAATRCITGVEALARWQRPGYGFVPPDIFIAAAETSGLIDR
LGLLVLRKACETARQWPSIKLSVNISPVQFRNPAFSGHVADILDVTQTPSERLRLEMTEG
YFIQHPERASAAIDKLKQLGLHIALDDFGAGFASVGYLRRFGFDRMKIDRSLIMALDKGG
RSLEMLQATVALAKSLDIPVTAEGVETEEQAAILHLCGCDELQGYLFSKPVAAEDITTML
DGQDAPLFALRAGA