Protein Info for Atu4487 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00005: ABC_tran" amino acids 24 to 171 (148 residues), 119.8 bits, see alignment E=2.1e-38 PF09383: NIL" amino acids 270 to 341 (72 residues), 65.4 bits, see alignment E=5.3e-22

Best Hits

Swiss-Prot: 100% identical to METN_AGRFC: Methionine import ATP-binding protein MetN (metN) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to atu:Atu4487)

MetaCyc: 46% identical to L-methionine/D-methionine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U7G2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Atu4487 ABC transporter permease (Agrobacterium fabrum C58)
MVTFEGVTKTFGGADGKPGFAALAGIDYTVPKGSITCIIGRSGAGKSTLIRLANGLEKPS
TGRVVVDGVDVAALDEKSLRTLRRSVGMIFQHFNLLSSRTAFDNVALPLEIAGLGKKEIE
ARVAPLLDLVGLSDKAKRYPAELSGGQKQRVGIARALATQPKLLLSDEATSALDPETTQS
ILELLKRINAELGLTVLLITHEMEVVKTIASQVAVIDRGLIVEEGTTFDIFTAPKHETTR
SLLSSSVGVKLPHWVTSGLKQEATDGDRVLVRLVFFGETAFQPLTARLVAEIGPDVNILA
GTIEEISGQPFGSLVVSYPASAEVTARANRFYAETGLHTEVLGYVA