Protein Info for Atu4483 in Agrobacterium fabrum C58

Annotation: xylose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR02630: xylose isomerase" amino acids 5 to 436 (432 residues), 687 bits, see alignment E=5.6e-211 PF27526: XylA2_C" amino acids 383 to 436 (54 residues), 60.8 bits, see alignment 1.3e-20

Best Hits

Swiss-Prot: 100% identical to XYLA_AGRFC: Xylose isomerase (xylA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01805, xylose isomerase [EC: 5.3.1.5] (inferred from 100% identity to atu:Atu4483)

MetaCyc: 61% identical to xylose isomerase (Escherichia coli K-12 substr. MG1655)
Xylose isomerase. [EC: 5.3.1.5]

Predicted SEED Role

"Xylose isomerase (EC 5.3.1.5)" in subsystem Xylose utilization (EC 5.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U7G6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Atu4483 xylose isomerase (Agrobacterium fabrum C58)
MSTGFFGDIAKIKYEGPDSTNPLAFRHYNPDEIVGGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFQRPWFEDTMQAAKLKADVAFEFFSLLGSPFYCFHDADVRPEGKNFAENTKNLNE
IVDYFAQKQADTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAFSAATVKTCMDATKTLG
GANYVLWGGREGYETLLNTDLSRELDQLGRFLNLVVEYKYKIGFEGTILIEPKPQEPTKH
QYDYDVATVYAFLQKNGLEKEVKVNIEQGHAILAGHSFEHELAMANAFGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKNGGTNFDSKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAAKMIEDGALSKPLSERYAKWDSPEAQKMLRGELKLEEIAALVERDDINPEP
KPGRQEYLENVVNRYV