Protein Info for Atu4468 in Agrobacterium fabrum C58

Annotation: iron transport ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 267 (254 residues), 256.2 bits, see alignment E=1.8e-80

Best Hits

Swiss-Prot: 55% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 100% identity to atu:Atu4468)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGQ2 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Atu4468 iron transport ABC transporter permease (Agrobacterium fabrum C58)
MSDTLELAILPFQLPFMQYAFVITLMIAVPMAMLSCFLVLKGWSLMGDAVSHAVLPGVVV
AYIAGIPLSIGAFIAGMICALGTGFIKENSRIKEDTVLGIVFSGMFGLGLVLYVKVQSDM
HLDHILFGDMLGIAPKDMLETGLIALFATLFLGILRKDLLVNAFDAQHAKAIGLPVRVLH
YGLLMILSLTVVGALKAVGIILSVAMLVTPGAIAFLLTRRFSAMMLAAIAVAVASSLSGI
WVSFLIDSAPAPTIVMFMSLAFVATFIRTTWKARRTDAARETGF