Protein Info for Atu4466 in Agrobacterium fabrum C58

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 184 (176 residues), 149.8 bits, E=1e-47
• PF13561: adh_short_C2
  • amino acids 15 to 242 (228 residues), 193.8 bits, E=5.4e-61

Best Hits

Swiss-Prot: 58% identical to BDH2_HUMAN: 3-hydroxybutyrate dehydrogenase type 2 (BDH2) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to atu:Atu4466)

MetaCyc: 62% identical to 2-dehydro-3-deoxy-D-pentonate/2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-22641 [EC: 1.1.1.434]; 1.1.1.434 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

• D-arabinose degradation IV (4/6 steps found)
• D-xylose degradation VI (3/5 steps found)
• L-fucose degradation III (5/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

See Q7CV11 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Atu4466 oxidoreductase (Agrobacterium fabrum C58)
MVQDFNGRTVVITAAGQGIGRATAERFISLGARVIATDINEQALSTLKGAETRVLNVLDG
DGVEDFAADIGHADVLFNCAGFVHSGTILDCEEKDWDFSFDLNAKAMYRTCRAFLPGMLE
KGKGAIVNMSSVASSVKGVPNRFAYTASKAAVVGLTKAIAADFVTKGIRCNAICPGTVDS
PSLHDRLRATGNYEQALADFIARQPMGRIATPEEIAALVTYLASDEAGFTTGQIHVIDGG
WTG