Protein Info for Atu4459 in Agrobacterium fabrum C58

Annotation: 6-O-methylguanine DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF12833: HTH_18" amino acids 41 to 119 (79 residues), 62.8 bits, see alignment E=3.1e-21 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 207 to 285 (79 residues), 102.2 bits, see alignment E=6.3e-34 PF01035: DNA_binding_1" amino acids 208 to 286 (79 residues), 103.4 bits, see alignment E=4.8e-34

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 100% identity to atu:Atu4459)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGP8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Atu4459 6-O-methylguanine DNA methyltransferase (Agrobacterium fabrum C58)
MNANIMLNEDITPIGSDYDTVRGVIELLTLDYREQPSLEAIAARLGQSPTQLQKTFTRWA
GLSPKAFLQAVTLDHAKRLLREEDLPLLETSIEVGMSGPGRLHDLFVTHEAMSPGEWKAK
GGGLTIRYGFHASPFGLALVMITDRGLAGCAFADPGDERACFEDMAGRWPNADYVEDREA
TAPYAARIFEPAMWTADKPLRVVLLGTDFQVRVWKSLLKIPMGRAVTYSNIACDIGQPTA
SRAVGAAVGANPVSFVVPCHRAVGKSGALTGYHWGLTRKRAMLGWETGKA