Protein Info for Atu4452 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00702: Hydrolase" amino acids 8 to 181 (174 residues), 89.3 bits, see alignment E=6.8e-29 PF13419: HAD_2" amino acids 10 to 186 (177 residues), 96.5 bits, see alignment E=3e-31 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 55 to 185 (131 residues), 68.6 bits, see alignment E=6.9e-23 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 81 to 181 (101 residues), 24.8 bits, see alignment E=2.6e-09 PF13242: Hydrolase_like" amino acids 143 to 194 (52 residues), 27.9 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4452)

Predicted SEED Role

"Hydrolase in polyol utilization gene cluster, haloacid dehalogenase-like family" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGP3 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu4452 hypothetical protein (Agrobacterium fabrum C58)
MRDGTGPLLIFDCDGVLVDSEPVSIAVLLDMLSHLGVTMGEEEAYERFLGRSVASMTTTL
FEEYGVETDIDFLDHMRATLFERFRTELKPIDGIAETLDELLPLKRCVASSSQPERIRYS
LGLTGLIDKFEPHVFSATMVRNGKPAPDLFLHAARSMGVEPRQCIVIEDSPAGIAAAKAA
GMGVFAFTGGSHARFPAFREKIAGLGADAVFDAMPDLVQLVGSYVGRGGFDGQVERDAG