Protein Info for Atu4425 in Agrobacterium fabrum C58

Annotation: inosine-uridine preferring nucleoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 3 to 291 (289 residues), 217.1 bits, E=2.2e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4425)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.1

Use Curated BLAST to search for 3.2.2.1

Sequence Analysis Tools

See A9CGM4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Atu4425 inosine-uridine preferring nucleoside hydrolase (Agrobacterium fabrum C58)
MGVWIDTDMGFDDIAAIMVVQSAGLAIDGISLVFGNATLDAVCRNAAGAVASFGWSMPIH
QGRAMPVLGALETAQSILGESGIPTAGQSLPDAPALPKSDAFTALCNWLEGEGEKRILAL
GPLTNIAALCLARPDLAARISDLTWMGGGLTSGNHTASAEFNAFADPEALAIVLAHGLPL
RMVDLDACRKVMASPADVLPIRTADGRNAGLIADLFDGFIGIATSRGRAAMALYDPVAAV
GFTSDHLGWQQARIDVELHASLTRGRTVVETRAEKVTDFNAQFAVTVDAGAAKAAILEAL
RREAAR