Protein Info for Atu4414 in Agrobacterium fabrum C58

Annotation: bacteriocin ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 32 to 34 (3 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 23 to 432 (410 residues), 390.5 bits, see alignment E=5.1e-121 PF25917: BSH_RND" amino acids 57 to 316 (260 residues), 29 bits, see alignment E=1.6e-10 PF25994: HH_AprE" amino acids 91 to 280 (190 residues), 144.2 bits, see alignment E=1.1e-45 PF26002: Beta-barrel_AprE" amino acids 322 to 411 (90 residues), 115.2 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to atu:Atu4414)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUW3 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Atu4414 bacteriocin ABC transporter permease (Agrobacterium fabrum C58)
MDEWQALRRSIRSHLLVGGLGFLTLTGVFGGWAVGTEIVGAVIAQGSLVVETSLKKVQHP
VGGVVSELMVRDGDRVKAGDVVMRIDATMTRANLAIVVKSLDQFTARKARLEGERDRAAS
VVFPQSLRDRAGDAEVLAMMNAEQRLYEDRRAVRESKKRQLEQRVRQLRDEISGLEAERA
ANVREQGMVDEELIRFRSLQERGLLDKSRLSTLERQATDIDGDIGRLRAGIAGIEAKISE
TALQILQIDEQWSEEVGSDLREMDARIGEYVERRVAAEDQLKRVDILAPQDGVVHQLAVH
TVGGVIAPGEQIMMIVPEVDKLVVEAKVAPQDIDQIYFGQVTNLRFSAFNQKTTPEITGT
VERISADVTVDQRTGASYYLVRVATSQEQIKRLGEFSLMPGMPVEAFITTGERSVLSYFL
KPLLDQANRTFRQA