Protein Info for Atu4406 in Agrobacterium fabrum C58

Annotation: periplasmic nitrate reductase, ferredoxin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR00402: ferredoxin-type protein NapF" amino acids 31 to 154 (124 residues), 105.4 bits, see alignment E=1.3e-34 PF13237: Fer4_10" amino acids 32 to 78 (47 residues), 31.7 bits, see alignment E=8e-11 PF00037: Fer4" amino acids 33 to 52 (20 residues), 24 bits, see alignment (E = 1.7e-08) amino acids 63 to 79 (17 residues), 21.6 bits, see alignment (E = 9.3e-08) amino acids 135 to 155 (21 residues), 33.4 bits, see alignment (E = 1.8e-11) PF13187: Fer4_9" amino acids 35 to 79 (45 residues), 38.5 bits, see alignment E=6e-13 amino acids 107 to 154 (48 residues), 32.4 bits, see alignment E=4.8e-11 PF12800: Fer4_4" amino acids 35 to 49 (15 residues), 16.2 bits, see alignment (E = 6.9e-06) amino acids 66 to 78 (13 residues), 10.9 bits, see alignment (E = 0.00036) amino acids 107 to 117 (11 residues), 11.6 bits, see alignment (E = 0.00022) amino acids 137 to 152 (16 residues), 22.6 bits, see alignment (E = 6.4e-08) PF12798: Fer4_3" amino acids 36 to 50 (15 residues), 16.1 bits, see alignment (E = 1.1e-05) amino acids 67 to 78 (12 residues), 14.2 bits, see alignment (E = 4.4e-05) amino acids 139 to 152 (14 residues), 20.6 bits, see alignment (E = 3.9e-07) PF12838: Fer4_7" amino acids 36 to 79 (44 residues), 38.3 bits, see alignment E=9.8e-13 amino acids 107 to 153 (47 residues), 44.1 bits, see alignment E=1.5e-14 PF14697: Fer4_21" amino acids 106 to 155 (50 residues), 36.8 bits, see alignment E=2.3e-12 PF12797: Fer4_2" amino acids 132 to 151 (20 residues), 27 bits, see alignment (E = 1.9e-09) PF12837: Fer4_6" amino acids 136 to 154 (19 residues), 28 bits, see alignment (E = 9.9e-10)

Best Hits

KEGG orthology group: K02572, ferredoxin-type protein NapF (inferred from 100% identity to atu:Atu4406)

Predicted SEED Role

"Ferredoxin-type protein NapF (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGL3 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Atu4406 periplasmic nitrate reductase, ferredoxin-like protein (Agrobacterium fabrum C58)
MTMDVSLSRRDFLRGGQKREMRICPPGVALSDLAACSGCAKCVEACPTGIITMVGGLPSV
NFSAGECTFCGKCAQACPEPVFATPDAHSFDHVMAIGEGCLAFGNVDCQACRDACPTEAI
RFRPRRGGPFVPALVEDACTGCGACVSVCPVGVIKIKETARETQYA