Protein Info for Atu4405 in Agrobacterium fabrum C58

Annotation: periplasmic nitrate reductase NapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 transmembrane" amino acids 20 to 51 (32 residues), see Phobius details PF06796: NapE" amino acids 13 to 58 (46 residues), 73.7 bits, see alignment E=3.6e-25 TIGR02973: periplasmic nitrate reductase, NapE protein" amino acids 16 to 57 (42 residues), 78.5 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: K02571, periplasmic nitrate reductase NapE (inferred from 100% identity to atu:Atu4405)

Predicted SEED Role

"Periplasmic nitrate reductase component NapE" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGL2 at UniProt or InterPro

Protein Sequence (61 amino acids)

>Atu4405 periplasmic nitrate reductase NapE (Agrobacterium fabrum C58)
MPKIVAPLHADGKPSRTKELITFAVLAFGIWPVLAVGFVGAFGFIVWMFQIIYGPPGPPG
H