Protein Info for Atu4394 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 30 to 482 (453 residues), 488.8 bits, E=6.8e-151
• PF20695: UbiD_N
  • amino acids 34 to 107 (74 residues), 83.3 bits, E=1.6e-27
• PF01977: UbiD
  • amino acids 150 to 349 (200 residues), 264.4 bits, E=7.5e-83
• PF20696: UbiD_C
  • amino acids 355 to 479 (125 residues), 156.7 bits, E=4.4e-50

Best Hits

Swiss-Prot: 56% identical to UBID_SACD2: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to atu:Atu4394)

MetaCyc: 54% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See A9CGK2 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Atu4394 hypothetical protein (Agrobacterium fabrum C58)
MPHNRLQTGGMTDEPTDIKAEAKPARTSDLRGFIRLLEERGQLRRIRQPVSLVHEITEIH
RRVLADGGPALLFEQPVDHEGKVRKMPLLANLFGTRQRIEWGLGLETGGLPALGQKLTEL
REPRPPKSMAEAWSKLPLLRAALSMRQRNVSRAPVQEKVLTRDAVDLARLPVQWCWPGEP
APLITWPLVITRSPDDPDDINVGIYRMQVLGPDRVIMRWLAHRGGAHHHRLWQARGLDMP
VTVAIGADPATILAAVMPLPDHISELGFSGLLRGAKSRIAKALTVPMPVPANAEIVLEGT
VSATETAMEGPYGDHTGYYNSVEAFPVMTLSAITMRRDPIYLSTYTGRPPDEPSVLGEAM
LEIFLPLVKRQFAEIVDLWMPPEACSYRVMVASIDKRYPGQAKRVMMGLWSMLPQFSYVK
LIILVDPDIDVRSWTDVVWALSTRFDASRDTTIINDTPIDYLDFASPKAGLGGKMGLDAT
RKLPPETEREWGRVLSMTPDVVAKVDLVWRDLGLGERP