Protein Info for Atu4393 in Agrobacterium fabrum C58

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 5 to 181 (177 residues), 221 bits, see alignment E=4.8e-70 PF02441: Flavoprotein" amino acids 5 to 172 (168 residues), 148.3 bits, see alignment E=7.8e-48

Best Hits

Swiss-Prot: 54% identical to PADL_BACSU: Probable UbiX-like flavin prenyltransferase (bsdB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to atu:Atu4393)

MetaCyc: 50% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGK1 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Atu4393 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Agrobacterium fabrum C58)
MTPCRVVVGVTGASGAGIALRIIERLAAMKSVEIHLVLSPSARRTVLHEEGAEGMGRMLS
LASVNHAVDDIGAAIASGSFPTTGMIVAPCSMRTLAAIATGLSDNLITRAADVHLKERRK
LVLMTRETPLHLIHLRNMCAVTEAGAIVMPPVPAFYNRPQSVFDIVDQLAARAIDQLGIS
SAPQAPIWQPHVVKTS