Protein Info for Atu4392 in Agrobacterium fabrum C58

Annotation: denitrification regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 61 (27 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details PF07298: NnrU" amino acids 4 to 221 (218 residues), 170.8 bits, see alignment E=1.4e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4392)

Predicted SEED Role

"NnrU family protein, required for expression of nitric oxide and nitrite reductases (Nir and Nor)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGK0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Atu4392 denitrification regulatory protein (Agrobacterium fabrum C58)
MLELVAALSLFVALHSVPAVPAVRGRLIAAVGRPAYLGAYSVVSLLTLSWVFHAALSVDY
IPLWDVAPWQAHVTFLAAPIGLFFVLAGLLSVNPLSISVRQGQQPGAIVRITRHPVLVGF
LFWSLGHVVPNGDLRSVILFGGFALFSLGGMAMTEKRARKRLGNAWNATAAGSATVPFAA
ILSGKTRIAVDGPMLLAAALTGLTVWWLLAGGHAMLFGADPMAYF