Protein Info for Atu4387 in Agrobacterium fabrum C58

Annotation: nitric oxide reductase NorQ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF07728: AAA_5" amino acids 37 to 171 (135 residues), 124.9 bits, see alignment E=3.8e-40 PF08406: CbbQ_C" amino acids 184 to 267 (84 residues), 111.6 bits, see alignment E=2.6e-36

Best Hits

Swiss-Prot: 66% identical to NORQ_PARDP: Protein NorQ (norQ) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K04748, nitric oxide reductase NorQ protein (inferred from 100% identity to atu:Atu4387)

Predicted SEED Role

"Nitric oxide reductase activation protein NorQ" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUT7 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Atu4387 nitric oxide reductase NorQ protein (Agrobacterium fabrum C58)
MNTIFRPAPHPLPDAPFYTPLGNECVLFESAWVRQLPLLLKGPTGCGKTRFVSHMAAKLG
LPLSTISCHDDLAAADLTGRYLLKGGETVWMDGPLTRSVRQGGICYLDEIVEARKDVAVV
LHPLTDDRRILPLERTGEVLEAPSGFMLVVSYNPGYQNLLKSLKPSTRQRFVAIEFDFLP
KEQEIAVVSHESGLDARDVEPLVDLAHRLRGLKGHDLEEGVSTRLLVYCASLIDTGLPAR
QAVRATMIEPLTDEPDVKAALHEVADAIIR