Protein Info for Atu4375 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF01408: GFO_IDH_MocA" amino acids 13 to 138 (126 residues), 71.7 bits, see alignment E=1.4e-23 PF22725: GFO_IDH_MocA_C3" amino acids 152 to 283 (132 residues), 113.4 bits, see alignment E=1e-36 PF02894: GFO_IDH_MocA_C" amino acids 155 to 386 (232 residues), 84 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 44% identical to Y4HM_SINFN: Uncharacterized oxidoreductase y4hM (NGR_a03370) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4375)

Predicted SEED Role

"Oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGI9 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Atu4375 hypothetical protein (Agrobacterium fabrum C58)
MSSATKKFDSRRIRLGMVGGGQGAFIGAVHRIAARLDDRYELVAGALSSDPARAAASATL
LGIAPERSYASFEDMAATEAGREDGIEAVAIVTPNHLHFAPSKAFLEAGIHVICDKPVTA
TLEEAKALAGIVRASDSLFVLTHNYTGYAMLRQMREMIAEGAIGKLRHVQAEYAQDWLTE
AVEKTGAKGAEWRTDPSRSGAGGAIGDIGTHAFNAAAFVTGEIPSSLYADLTSFVPGRQL
DDSANILLRYDSGAKGMLWASQIAVGNENALSLRVYGDKGGLEWHHRVPDELWFTPYGEP
KRLITRNGAGAGAAANRVSRVPSGHPEGYLEGFATIYREAADAIIAKREGETAAGEVIYP
GMEDGLAGLAFIDAAVRSSQTSTWVGIDI