Protein Info for Atu4355 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details PF03741: TerC" amino acids 15 to 203 (189 residues), 163.2 bits, see alignment E=8.1e-52 PF00571: CBS" amino acids 372 to 421 (50 residues), 28.9 bits, see alignment 1.7e-10 PF03471: CorC_HlyC" amino acids 438 to 510 (73 residues), 63.3 bits, see alignment E=2.6e-21

Best Hits

Swiss-Prot: 52% identical to YEGH_ECOLI: UPF0053 protein YegH (yegH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4355)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGH4 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Atu4355 hypothetical protein (Agrobacterium fabrum C58)
MEFLADPNIWVGLVTLIVLEVVLGIDNLVFIAILADKLPPHQRQKARMIGLSLALVMRLL
LLFSISWIVTLTRPLFTISDFSFSGRDLILILGGAFLLAKGTMELHERLEGDQKPKQGKV
VHAVFWQVIVQIVVLDAVFSLDSVITAVGMVNNLWVMITAVCVAMAVMMAASRPLMAFVS
KHPTVVILCLGFLLMIGFSLIVEGFGFHLPKGYLYAAIGFSVLIEAANQIGRRNRERRIT
AGDMRERTSDAILRLLGGRVGEQQSLGETADVIAAQAAQGDLFKSEEKDMIRGVLTLAER
PVVSIMTPRTEIDWLDIDADHDTLRSRLLELDHSRLMLAQGKLDSFLGVAATRDLLRDLL
HDGKLNLERSLREPLVVHESATALQVMEQLRTSPLQMAVIIDEYGTLQGIATPTDILEAI
AGEFPDEGEEAQISGLEQDGSWLIDGTVDIRRVSYLLDIDLVDDADRYSTIAGYILWRLS
RLPEIGERISGDGFEFEIVSCSDRNIEKIRAWNTSLAT