Protein Info for Atu4323 in Agrobacterium fabrum C58

Annotation: ribitol 2-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF00106: adh_short" amino acids 8 to 196 (189 residues), 171.4 bits, see alignment E=3.4e-54 PF08659: KR" amino acids 11 to 173 (163 residues), 25 bits, see alignment E=3.2e-09 PF13561: adh_short_C2" amino acids 14 to 225 (212 residues), 124 bits, see alignment E=1.5e-39

Best Hits

Swiss-Prot: 47% identical to RIDH_KLEAE: Ribitol 2-dehydrogenase (rbtD) from Klebsiella aerogenes

KEGG orthology group: K00039, ribitol 2-dehydrogenase [EC: 1.1.1.56] (inferred from 100% identity to atu:Atu4323)

MetaCyc: 47% identical to ribitol dehydrogenase subunit (Klebsiella aerogenes)
Ribitol 2-dehydrogenase. [EC: 1.1.1.56]

Predicted SEED Role

"Ribitol 2-dehydrogenase (EC 1.1.1.56)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGF5 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Atu4323 ribitol 2-dehydrogenase (Agrobacterium fabrum C58)
MSESLQGKIAVITGAASGIGLATTEALLEQGATVVMVDWNEKALNDLAAKLGERAIPQVT
NLLDADSCNAMIPEILGKVDHIDILYCNAGTYIGGDLTETTPEAIDKMLNLNVNAVMKNV
QAVVPHMSERKTGDIIVTCSIAGHFPTYWEPVYSGSKWAITSFVQGMRRQMIPHGVRVAQ
VSPGPVVSALLADWPEENLRKAKESGSLIDASEVADAVVYMLTRKRTVTIRDMLVLPTNF
DRV