Protein Info for Atu4322 in Agrobacterium fabrum C58

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 60 to 91 (32 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 262 to 292 (31 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 317 (266 residues), 155.5 bits, see alignment E=7.8e-50

Best Hits

Swiss-Prot: 50% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to atu:Atu4322)

MetaCyc: 48% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGF4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Atu4322 ribose ABC transporter permease (Agrobacterium fabrum C58)
MSLDANTGVAAKTGGFSFSAMLRSPLALPLAGLIVVSILMGLASDNFFSVNNIMNVLRQV
SVVGILAVGMTFVILTGGIDLSVGAVMALVGTLSAGLMVNTGLSPAIALPAGLFIGLGIG
IFNGALVAWGRMPAIIVTLATMGMARGLGLIYSGGYPVSGIPSWISWFGVGRVGIVPVPV
IIMVVIYAVAWVLLQRTAFGRHVYALGGNELAARLSGVKTRRVKLAVYGISGVTAAFAAL
ILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLILGTLIGAVLLGILNNGLNLMG
INPYLQDVIKGGIILLAIYIGREWR