Protein Info for Atu4318 in Agrobacterium fabrum C58

Annotation: xylitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF08240: ADH_N" amino acids 30 to 141 (112 residues), 92.6 bits, see alignment E=2.1e-30 PF16912: Glu_dehyd_C" amino acids 165 to 311 (147 residues), 40 bits, see alignment E=4.7e-14 PF00107: ADH_zinc_N" amino acids 181 to 308 (128 residues), 71.9 bits, see alignment E=7.3e-24

Best Hits

Swiss-Prot: 100% identical to XYLD_AGRFC: Putative D-xylulose reductase (Atu4318) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K05351, D-xylulose reductase [EC: 1.1.1.9] (inferred from 100% identity to atu:Atu4318)

MetaCyc: 59% identical to xylitol dehydrogenase (Morganella morganii)
D-xylulose reductase. [EC: 1.1.1.9]

Predicted SEED Role

"Xylitol dehydrogenase (EC 1.1.1.9)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U7Y1 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Atu4318 xylitol dehydrogenase (Agrobacterium fabrum C58)
MKALVLEEKGKLSLRDFDIPGGAGSGELGPKDVRIRTHTVGICGSDVHYYTHGKIGHFVV
NAPMVLGHEASGTVIETGSDVTHLKIGDRVCMEPGIPDPTSRASKLGIYNVDPAVRFWAT
PPIHGCLTPEVIHPAAFTYKLPDNVSFAEGAMVEPFAIGMQAALRARIQPGDIAVVTGAG
PIGMMVALAALAGGCAKVIVADLAQPKLDIIAAYDGIETINIRERNLAEAVSAATDGWGC
DIVFECSGAAPAILGMAKLARPGGAIVLVGMPVDPVPVDIVGLQAKELRVETVFRYANVY
DRAVALIASGKVDLKPLISATIPFEDSIAGFDRAVEARETDVKLQIVMPQ