Protein Info for Atu4308 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details amino acids 222 to 250 (29 residues), see Phobius details PF09955: DUF2189" amino acids 72 to 198 (127 residues), 131.2 bits, see alignment E=1.3e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4308)

Predicted SEED Role

"FIG00983951: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUL1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Atu4308 hypothetical protein (Agrobacterium fabrum C58)
MTAFHVMAGASGEYTRPEVRKIGVADIVDALRLGLDDFKEKPSHYVFLCLMYPIAGVFLV
MWSSGANLPPLIYPLMSGFALIGPIAAISLYEISRRREQGLDSSWRHALEVRHSPAMPSI
IAVAVMLLALFAVWLIVAQSIYTATFDAAGPVSLSTFVSDVMTTSQGLSLIIWGNLAGFV
FAVIVLATTVVTFPLLLDRDVGAVAAVEASIRATLANPVPVMLWGLIVAALLFVGTIPAF
IGLAVVMPILGHSTWHLYRKLIVPGYPGHKP