Protein Info for Atu4295 in Agrobacterium fabrum C58

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 21 to 94 (74 residues), 73 bits, E=3e-24
• TIGR00507: shikimate dehydrogenase
  • amino acids 23 to 277 (255 residues), 215.8 bits, E=3.2e-68
• PF01488: Shikimate_DH
  • amino acids 120 to 198 (79 residues), 34.9 bits, E=2.4e-12
• PF18317: SDH_C
  • amino acids 248 to 277 (30 residues), 38.3 bits, see alignment (E = 1.3e-13)

Best Hits

Swiss-Prot: 38% identical to AROE_GEOKA: Shikimate dehydrogenase (NADP(+)) (aroE) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to atu:Atu4295)

MetaCyc: 53% identical to 5-ketofructose reductase (NADP) monomer (Tatumella morbirosei)
Fructose 5-dehydrogenase (NADP(+)). [EC: 1.1.1.124]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.124 or 1.1.1.25

Sequence Analysis Tools

See Q7CUJ9 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Atu4295 shikimate 5-dehydrogenase (Agrobacterium fabrum C58)
MPHDFLAEITGSFAMPAGENPTVAMIEAAYQHHGLNWRYINLEVSPENLKDAVAGARAMG
WAGFNCSIPHKVAVIQHLDGLGESAEIIGAVNTIVRRGDRLIGENTDGKGFVKALRDVID
PKDKKVVLFGAGGAARAVCVEVALAGAAHITVVNRNRERGETVARLIDEKTPATATFAAW
EDAFAIPEETDIVIHATSVGLYPDIDGLPDIDLKTLRPSMVVADGIHNPPRTRLIRAAEA
AGSKTADGLGMLVNQGVIGIKYWTGVDVDAYVMRQALVDLNL