Protein Info for Atu4272 in Agrobacterium fabrum C58

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 73 to 146 (74 residues), 66.2 bits, E=1.9e-22

Best Hits

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to atu:Atu4272)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)

Sequence Analysis Tools

See A9CGC6 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Atu4272 acetyl-CoA carboxylase biotin carboxyl carrier protein (Agrobacterium fabrum C58)
MDLPKIKTLIDFVGRTNVTELTVTEKKVTVRIFRTVGQSATIAETNSTEGEVAGPASSAD
VSTSVVSAGSTFTVKAPVFGVLHRSPTPGQKPFVNVGDRVEEGQTLFIIEAMKVFNTIAA
PHAGRIAYLTEVDGGEVETGDVLAEIA